PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RW5KN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 598aa    MW: 69080.1 Da    PI: 6.0979
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RW5KNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix39.41.6e-12119184270
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70 
                  W+++ev aL+++r+ m+++   +    + W++vs+k+ e gf++s  +Ckek+e+  +++ + +++++ 
  Aradu.RW5KN 119 WSNDEVVALLRIRSTMDTTWFPQ---LTYWDHVSRKLGELGFKKSGDKCKEKFEDETRYFNNYAKNNSY 184
                  *****************998776...89********************************999988865 PP

2trihelix90.12.5e-28453544186
     trihelix   1 rWtkqevlaLiearr.......emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  rW+++evlaLi++r        + eer + ++ k plWe++s+ m++ g++rs+k+Ckekwen+nk+++k+k+ +kkr s +s+tcpyf+ql+
  Aradu.RW5KN 453 RWPRDEVLALINLRCesikmnnNAEERESGNNNKIPLWERISQGMSDLGYKRSAKRCKEKWENINKYFRKTKDVNKKR-SIDSRTCPYFHQLK 544
                  8*************977744333333333357999******************************************8.78889*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.017111172IPR017877Myb-like domain
SMARTSM0071710115174IPR001005SANT/Myb domain
PfamPF138372.0E-8118182No hitNo description
PROSITE profilePS500906.365446517IPR017877Myb-like domain
SMARTSM007171.2450519IPR001005SANT/Myb domain
CDDcd122038.85E-24452524No hitNo description
PfamPF138372.1E-19452546No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0001158Molecular Functionenhancer sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MFDGLPSSSE HFHQFITPRT TTSTTLPLPH HHHHHHHLSP SSSSSSSSFS PLLHHHASLT  60
PINTNTFLPF DPYNPHHQQQ QPNATFSSVL NNNNLFHTSA TDERVQTQVL PNDLIDSSWS  120
NDEVVALLRI RSTMDTTWFP QLTYWDHVSR KLGELGFKKS GDKCKEKFED ETRYFNNYAK  180
NNSYRFLNEL EEFYQGDNHN ENPMVDNQDH VVTEKTQEFE HPMNAGGGDI EEVEEEEEEE  240
EEEEEESSRD GKSVKEQCEE DNESEKKMKM KRKRKRRCRF EMLKGFCESI VNNMMAQQEE  300
IHNKLIEDML RRDEEKLQRE EAWKKQETER MNKELQIMAQ EQAIAGDRQA SIIEFLKKYA  360
ATNPNNNEPT PSSSKLIIPS SHQIQIPPLS AENPSSMSDT LLQQVHSSST HSSPASHNNT  420
TSSSSLNRHD NYHSNLLVKP LVTDQKENNV GRRWPRDEVL ALINLRCESI KMNNNAEERE  480
SGNNNKIPLW ERISQGMSDL GYKRSAKRCK EKWENINKYF RKTKDVNKKR SIDSRTCPYF  540
HQLKSLYDEG KLVHQPETTT SENHSGQLLP PSDQVGSGGG FSDDHEKTLI QEPPLNFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265275KKMKMKRKRKR
2270276KRKRKRR
3271276RKRKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00011PBMTransfer from AT5G28300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150414e-56AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015968510.10.0PREDICTED: trihelix transcription factor GTL2-like
TrEMBLA0A0B2SG001e-156A0A0B2SG00_GLYSO; Trihelix transcription factor GTL2
TrEMBLI1NC801e-156I1NC80_SOYBN; Uncharacterized protein
STRINGGLYMA19G43280.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50433355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28300.17e-72Trihelix family protein